PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00111g01236.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family STAT
Protein Properties Length: 672aa    MW: 75798.7 Da    PI: 5.6894
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00111g01236.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT192.44.7e-602133321120
                      STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfri 85 
                               ldv+l++ +++p++ +vevvasL+yad+ ++veksdd+eapLL+sydG+e++s+drp+k++ GrasfklkisqLsskcdnrLfri
  Peaxi162Scf00111g01236.1 213 LDVTLMDNFSRPMTEEVEVVASLVYADNEAPVEKSDDDEAPLLTSYDGIEYASSDRPSKVISGRASFKLKISQLSSKCDNRLFRI 297
                               89*********************************************************************************** PP

                      STAT  86 kfeipklkkypfleavskpirCisrsrntrssslt 120
                               +f+ipk+ kypfle++s+p+rCisr+rn r++sl+
  Peaxi162Scf00111g01236.1 298 RFDIPKMGKYPFLEVLSRPVRCISRNRNIRATSLM 332
                               ******************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.60.120.2002.8E-520143IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF498992.85E-920132IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF555506.78E-8605668IPR000980SH2 domain
Gene3DG3DSA:3.30.505.105.0E-6605664IPR000980SH2 domain
PROSITE profilePS5000110.152606672IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 672 aa     Download sequence    Send to blast
MGFQDHVFLK DLQVEFKDYE ETNGFSLCFW FFLNEASTLP STILHQEHPD VMSHVPFLLL  60
DEKKRILLFP LQSSSHSNVT SWREVTYATS LNEFPTKRWV HIGCEVRHDL LRLYLDGEIV  120
GEMALTSSIN NDLGSDSSRI SLTCISGKYS QLDGYAHGAE LLPIVSSIKG HYVKDPPVQL  180
SIDSSSAYEI EEDTDGVWSI VSGKASCRRN FSLDVTLMDN FSRPMTEEVE VVASLVYADN  240
EAPVEKSDDD EAPLLTSYDG IEYASSDRPS KVISGRASFK LKISQLSSKC DNRLFRIRFD  300
IPKMGKYPFL EVLSRPVRCI SRNRNIRATS LMLTKSSLGT HLLNGSQSPE LEDGSSDLLP  360
CIVREAKPSP SSKRVKLGQE KLCANFKDDF VLKQANGESK SHSWTSEDNY AYRNPLVARP  420
VIHGGAENFS SDSENSETTN LVLDDLPSNR DPISDLAVFK YCLGDLNERR LLLKEMAMTA  480
RQEELAAFSE KVSLFSGCSH HRHQISISKR LIEEGIKCWN LISNDNHHVL WDTLVCGLQE  540
HFLKTTFGCN RSLTLQDFSL LRRVAGCQDL VSQDNFEKLW CWLYPVAFTL SQQCITSLWL  600
SRSPLWIEGF ITKEEAESSL RGLGALQDPG TFVLRFPTSR SWPHPDAGNL VVTYVGSDSN  660
IHHRLVSLDF IY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2103541e-135AC210354.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 7 clone C07HBa0102J11, complete sequence.
GenBankHG9755191e-135HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006348345.10.0PREDICTED: uncharacterized protein LOC102592228
TrEMBLA0A0V0INF70.0A0A0V0INF7_SOLCH; Putative ovule protein
STRINGSolyc07g062050.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA93942325
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17040.10.0SH2 domain protein A